| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
| Species Decarboxylase catalytic Fab 21D8, chimeric (mouse V domains/human C1 domains) [48903] (2 PDB entries) |
| Domain d1c5ch1: 1c5c H:1-113 [20475] Other proteins in same PDB: d1c5ch2, d1c5cl2 |
PDB Entry: 1c5c (more details), 1.61 Å
SCOP Domain Sequences for d1c5ch1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c5ch1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Decarboxylase catalytic Fab 21D8, chimeric (mouse V domains/human C1 domains)}
qvqllepgtelvkpgasvklscrasgysftsywmhwvkqrpgqglewiglidpsngrtnf
ndkfksratltvdtssstaymqlssltsedsavyycvriaywgqgtlvtvss
Timeline for d1c5ch1: