Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (18 species) not a true protein |
Species Staphylococcus aureus [TaxId:93062] [225144] (2 PDB entries) |
Domain d2i87b2: 2i87 B:129-360 [204749] Other proteins in same PDB: d2i87a1, d2i87b1 automated match to d1ehib2 complexed with so4 |
PDB Entry: 2i87 (more details), 2 Å
SCOPe Domain Sequences for d2i87b2:
Sequence, based on SEQRES records: (download)
>d2i87b2 d.142.1.0 (B:129-360) automated matches {Staphylococcus aureus [TaxId: 93062]} dklvmkqlfehrglpqlpyisflrseyekyehnilklvndklnypvfvkpanlgssvgis kcnneaelkegikeafqfdrklvieqgvnareievavlgndypeatwpgevvkdvafydy kskykdgkvqlqipadldedvqltlrnmaleafkatdcsglvradffvtednqiyinetn ampgftafsmypklwenmglsypelitklielakerhqdkqknkykidrshh
>d2i87b2 d.142.1.0 (B:129-360) automated matches {Staphylococcus aureus [TaxId: 93062]} dklvmkqlfehrglpqlpyisflrseyekyehnilklvndklnypvfvkpanlgssvgis kcnneaelkegikeafqfdrklvieqgvnareievavlgndypeatwpgevvkdvafvql qipadldedvqltlrnmaleafkatdcsglvradffvtednqiyinetnampgftafsmy pklwenmglsypelitklielakerhqdkqknkykidrshh
Timeline for d2i87b2: