Lineage for d2i87b2 (2i87 B:129-360)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432977Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1432978Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1433300Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 1433301Protein automated matches [226904] (18 species)
    not a true protein
  7. 1433347Species Staphylococcus aureus [TaxId:93062] [225144] (2 PDB entries)
  8. 1433349Domain d2i87b2: 2i87 B:129-360 [204749]
    Other proteins in same PDB: d2i87a1, d2i87b1
    automated match to d1ehib2
    complexed with so4

Details for d2i87b2

PDB Entry: 2i87 (more details), 2 Å

PDB Description: allosteric inhibition of staphylococcus aureus d-alanine:d-alanine ligase revealed by crystallographic studies
PDB Compounds: (B:) D-alanine-D-alanine ligase

SCOPe Domain Sequences for d2i87b2:

Sequence, based on SEQRES records: (download)

>d2i87b2 d.142.1.0 (B:129-360) automated matches {Staphylococcus aureus [TaxId: 93062]}
dklvmkqlfehrglpqlpyisflrseyekyehnilklvndklnypvfvkpanlgssvgis
kcnneaelkegikeafqfdrklvieqgvnareievavlgndypeatwpgevvkdvafydy
kskykdgkvqlqipadldedvqltlrnmaleafkatdcsglvradffvtednqiyinetn
ampgftafsmypklwenmglsypelitklielakerhqdkqknkykidrshh

Sequence, based on observed residues (ATOM records): (download)

>d2i87b2 d.142.1.0 (B:129-360) automated matches {Staphylococcus aureus [TaxId: 93062]}
dklvmkqlfehrglpqlpyisflrseyekyehnilklvndklnypvfvkpanlgssvgis
kcnneaelkegikeafqfdrklvieqgvnareievavlgndypeatwpgevvkdvafvql
qipadldedvqltlrnmaleafkatdcsglvradffvtednqiyinetnampgftafsmy
pklwenmglsypelitklielakerhqdkqknkykidrshh

SCOPe Domain Coordinates for d2i87b2:

Click to download the PDB-style file with coordinates for d2i87b2.
(The format of our PDB-style files is described here.)

Timeline for d2i87b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i87b1