Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
Protein automated matches [226903] (35 species) not a true protein |
Species Staphylococcus aureus [TaxId:93062] [225143] (2 PDB entries) |
Domain d2i87b1: 2i87 B:3-128 [204748] Other proteins in same PDB: d2i87a2, d2i87a3, d2i87b2, d2i87b3 automated match to d1ehib1 complexed with so4 |
PDB Entry: 2i87 (more details), 2 Å
SCOPe Domain Sequences for d2i87b1:
Sequence, based on SEQRES records: (download)
>d2i87b1 c.30.1.0 (B:3-128) automated matches {Staphylococcus aureus [TaxId: 93062]} kenicivfggksaehevsiltaqnvlnaidkdkyhvdiiyitndgdwrkqnnitaeikst delhlengealeisqllkesssgqpydavfpllhgpngedgtiqglfevldvpyvgngvl saassm
>d2i87b1 c.30.1.0 (B:3-128) automated matches {Staphylococcus aureus [TaxId: 93062]} kenicivfggksaehevsiltaqnvlnaidkdkyhvdiiyitndgdwrkqnnitaeikst delhlengeleisqllkesssgqpydavfpllhgpedgtiqglfevldvpyvgngvlsaa ssm
Timeline for d2i87b1: