Lineage for d2i87b1 (2i87 B:3-128)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120504Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2120505Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2120847Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2120848Protein automated matches [226903] (35 species)
    not a true protein
  7. 2120966Species Staphylococcus aureus [TaxId:93062] [225143] (2 PDB entries)
  8. 2120968Domain d2i87b1: 2i87 B:3-128 [204748]
    Other proteins in same PDB: d2i87a2, d2i87a3, d2i87b2, d2i87b3
    automated match to d1ehib1
    complexed with so4

Details for d2i87b1

PDB Entry: 2i87 (more details), 2 Å

PDB Description: allosteric inhibition of staphylococcus aureus d-alanine:d-alanine ligase revealed by crystallographic studies
PDB Compounds: (B:) D-alanine-D-alanine ligase

SCOPe Domain Sequences for d2i87b1:

Sequence, based on SEQRES records: (download)

>d2i87b1 c.30.1.0 (B:3-128) automated matches {Staphylococcus aureus [TaxId: 93062]}
kenicivfggksaehevsiltaqnvlnaidkdkyhvdiiyitndgdwrkqnnitaeikst
delhlengealeisqllkesssgqpydavfpllhgpngedgtiqglfevldvpyvgngvl
saassm

Sequence, based on observed residues (ATOM records): (download)

>d2i87b1 c.30.1.0 (B:3-128) automated matches {Staphylococcus aureus [TaxId: 93062]}
kenicivfggksaehevsiltaqnvlnaidkdkyhvdiiyitndgdwrkqnnitaeikst
delhlengeleisqllkesssgqpydavfpllhgpedgtiqglfevldvpyvgngvlsaa
ssm

SCOPe Domain Coordinates for d2i87b1:

Click to download the PDB-style file with coordinates for d2i87b1.
(The format of our PDB-style files is described here.)

Timeline for d2i87b1: