Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (147 species) not a true protein |
Species Plasmodium vivax [TaxId:126793] [225142] (1 PDB entry) |
Domain d2i81c_: 2i81 C: [204743] automated match to d1uula_ |
PDB Entry: 2i81 (more details), 2.45 Å
SCOPe Domain Sequences for d2i81c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i81c_ c.47.1.0 (C:) automated matches {Plasmodium vivax [TaxId: 126793]} ptyvgkeapffkaeavfgdnsfgevnltqfigkkyvllyfypldftfvcpseiialdkal dafhernvellgcsvdskythlawkktplakggignikhtllsditksiskdynvlfdds vslrafvlidmngivqhllvnnlaigrsvdeilriidaiqhhekygdvcpanwqkgkvsm kpseegvaqylst
Timeline for d2i81c_:
View in 3D Domains from other chains: (mouse over for more information) d2i81a_, d2i81b_, d2i81d_, d2i81e_ |