Lineage for d1c5cl1 (1c5c L:1-107)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 451612Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 452039Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (162 PDB entries)
  8. 452043Domain d1c5cl1: 1c5c L:1-107 [20474]
    Other proteins in same PDB: d1c5ch1, d1c5ch2, d1c5cl2
    part of humanized catalytic Fab 21D8 with a decarboxylase activity

Details for d1c5cl1

PDB Entry: 1c5c (more details), 1.61 Å

PDB Description: decarboxylase catalytic antibody 21d8-hapten complex
PDB Compounds: (L:)

SCOP Domain Sequences for d1c5cl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
eiqltqspsslsaslgervsltcrtsqeisgylswlqqkpdgtikrliydatkldsgapk
rfsgsrsgsdysltisslesedfadyyclqyasfprtfgggtkleik

SCOP Domain Coordinates for d1c5cl1:

Click to download the PDB-style file with coordinates for d1c5cl1.
(The format of our PDB-style files is described here.)

Timeline for d1c5cl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c5cl2