Lineage for d2i79d_ (2i79 D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426873Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1426874Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1427400Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1427401Protein automated matches [190038] (22 species)
    not a true protein
  7. 1427492Species Streptococcus pneumoniae [TaxId:170187] [225152] (1 PDB entry)
  8. 1427496Domain d2i79d_: 2i79 D: [204735]
    automated match to d2ae6d_
    complexed with aco

Details for d2i79d_

PDB Entry: 2i79 (more details), 2.1 Å

PDB Description: The crystal structure of the acetyltransferase of GNAT family from Streptococcus pneumoniae
PDB Compounds: (D:) acetyltransferase, GNAT family

SCOPe Domain Sequences for d2i79d_:

Sequence, based on SEQRES records: (download)

>d2i79d_ d.108.1.0 (D:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
ellireaepkdaaelvaflnrvsletdftsldgdgilltseemeiflnkqassdnqitll
aflngkiagivnitadqrkrvrhigdlfivigkrywnnglgsllleeaiewaqasgilrr
lqltvqtrnqaavhlyqkhgfviegsqergayieegkfidvylmgklig

Sequence, based on observed residues (ATOM records): (download)

>d2i79d_ d.108.1.0 (D:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
ellireaepkdaaelvaflnrvsletdftsldgdgilltseemeiflnkqassdnqitll
aflngkiagivnitadqrkrvrhigdlfivigkrywnnglgsllleeaiewaqasgilrr
lqltvqtrnqaavhlyqkhgfviegsqergayiekfidvylmgklig

SCOPe Domain Coordinates for d2i79d_:

Click to download the PDB-style file with coordinates for d2i79d_.
(The format of our PDB-style files is described here.)

Timeline for d2i79d_: