Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
Protein automated matches [226938] (26 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [225283] (1 PDB entry) |
Domain d2i6ua2: 2i6u A:144-307 [204730] Other proteins in same PDB: d2i6ua3, d2i6ub3, d2i6uc3 automated match to d1duvg2 complexed with cp, nva, so4 |
PDB Entry: 2i6u (more details), 2.2 Å
SCOPe Domain Sequences for d2i6ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i6ua2 c.78.1.0 (A:144-307) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} galrglrlsyfgdgannmahslllggvtagihvtvaapegflpdpsvraaaerraqdtga svtvtadahaaaagadvlvtdtwtsmgqendgldrvkpfrpfqlnsrllaladsdaivlh clpahrgdeitdavmdgpasavwdeaenrlhaqkallvwllers
Timeline for d2i6ua2: