Lineage for d2i6ua2 (2i6u A:144-307)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906884Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2906885Protein automated matches [226938] (26 species)
    not a true protein
  7. 2907008Species Mycobacterium tuberculosis [TaxId:1773] [225283] (1 PDB entry)
  8. 2907010Domain d2i6ua2: 2i6u A:144-307 [204730]
    Other proteins in same PDB: d2i6ua3, d2i6ub3, d2i6uc3
    automated match to d1duvg2
    complexed with cp, nva, so4

Details for d2i6ua2

PDB Entry: 2i6u (more details), 2.2 Å

PDB Description: Crystal Structure of Ornithine Carbamoyltransferase complexed with Carbamoyl Phosphate and L-Norvaline from Mycobacterium tuberculosis (Rv1656) at 2.2 A
PDB Compounds: (A:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d2i6ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i6ua2 c.78.1.0 (A:144-307) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
galrglrlsyfgdgannmahslllggvtagihvtvaapegflpdpsvraaaerraqdtga
svtvtadahaaaagadvlvtdtwtsmgqendgldrvkpfrpfqlnsrllaladsdaivlh
clpahrgdeitdavmdgpasavwdeaenrlhaqkallvwllers

SCOPe Domain Coordinates for d2i6ua2:

Click to download the PDB-style file with coordinates for d2i6ua2.
(The format of our PDB-style files is described here.)

Timeline for d2i6ua2: