Lineage for d2i6tb1 (2i6t B:182-318)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847056Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries)
  8. 2847167Domain d2i6tb1: 2i6t B:182-318 [204727]
    Other proteins in same PDB: d2i6ta2, d2i6tb2
    automated match to d1ez4a1
    complexed with gol, so4

Details for d2i6tb1

PDB Entry: 2i6t (more details), 2.1 Å

PDB Description: orthorhombic structure of the ldh domain of human ubiquitin- conjugating enzyme e2-like isoform a
PDB Compounds: (B:) ubiquitin-conjugating enzyme e2-like isoform a

SCOPe Domain Sequences for d2i6tb1:

Sequence, based on SEQRES records: (download)

>d2i6tb1 c.2.1.0 (B:182-318) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnkitvvgggelgiactlaisakgiadrlvlldlsegtkgatmdleifnlpnveiskdls
asahskvviftvnslgssqsyldvvqsnvdmfralvpalghysqhsvllvasqpveimty
vtwklstfpanrvigig

Sequence, based on observed residues (ATOM records): (download)

>d2i6tb1 c.2.1.0 (B:182-318) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnkitvvgggelgiactlaisakgiadrlvlldlseggatmdleifnlpnveiskdlsas
ahskvviftvnsqsyldvvqsnvdmfralvpalghysqhsvllvasqpveimtyvtwkls
tfpanrvigig

SCOPe Domain Coordinates for d2i6tb1:

Click to download the PDB-style file with coordinates for d2i6tb1.
(The format of our PDB-style files is described here.)

Timeline for d2i6tb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i6tb2