Lineage for d2i6sa2 (2i6s A:443-732)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2058159Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2058160Protein automated matches [190438] (24 species)
    not a true protein
  7. 2058190Species Human (Homo sapiens) [TaxId:9606] [187421] (73 PDB entries)
  8. 2058224Domain d2i6sa2: 2i6s A:443-732 [204724]
    Other proteins in same PDB: d2i6sa1, d2i6sa3
    automated match to d1rrka1
    complexed with nag

Details for d2i6sa2

PDB Entry: 2i6s (more details), 2.7 Å

PDB Description: Complement component C2a
PDB Compounds: (A:) Complement C2a fragment

SCOPe Domain Sequences for d2i6sa2:

Sequence, based on SEQRES records: (download)

>d2i6sa2 b.47.1.0 (A:443-732) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cgvgnmsanasdqertpwhvtikpksqetcrgalisdqwvltaahcfrdgndhslwrvnv
gdpksqwgkefliekavispgfdvfakknqgilefygddiallklaqkvkmstharpicl
pctmeanlalrrpqgstcrdhenellnkqsvpahfvalngsklninlkmgvewtscaevv
sqektmfpnltdvrevvtdqflcsgtqedespckgesggavflerrfrffqvglvswgly
npclgsadknsrkraprskvppprdfhinlfrmqpwlrqhlgdvlnflpl

Sequence, based on observed residues (ATOM records): (download)

>d2i6sa2 b.47.1.0 (A:443-732) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cgvgnmsanasdqertpwhvtikpksqetcrgalisdqwvltaahcfrdgndhslwrvnv
gdpksqwgkefliekavispgfdvfakknqgilefygddiallklaqkvkmstharpicl
pctmeanlalrrpqgstcrdhenellnkqsvpahfvalngsklninlkmgvewtscaevv
sqektmfpnltdvrevvtdqflcsgtqedespckgesggavflerrfrffqvglvswgly
npclgsadkraprskvppprdfhinlfrmqpwlrqhlgdvlnflpl

SCOPe Domain Coordinates for d2i6sa2:

Click to download the PDB-style file with coordinates for d2i6sa2.
(The format of our PDB-style files is described here.)

Timeline for d2i6sa2: