SCOPe 2.05: Domain d2i6qa1: 2i6q A:223-442

Lineage for d2i6qa1 (2i6q A:223-442)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.0: automated matches [191586] (1 protein)
   not a true family

6. Protein automated matches [191045] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188880] (10 PDB entries)

8. Domain d2i6qa1: 2i6q A:223-442 [204721]
   Other proteins in same PDB: d2i6qa2
   automated match to d1rrka2
   complexed with mli, mn, nag

Details for d2i6qa1

PDB Entry: 2i6q, 2.1 Å

PDB Description: complement component c2a

PDB Compounds: (A:) Complement C2a fragment

SCOPe Domain Sequences for d2i6qa1:

Sequence; same for both SEQRES and ATOM records:

>d2i6qa1 c.62.1.0 (A:223-442) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skiqiqrsghlnlyllldcsqsvsendflifkesaslmvdrifsfeinvsvaiitfasep
kvlmsvlndnsrdmtevisslenanykdhengtgtntyaalnsvylmmnnqmrllgmetm
awqeirhaiilltdgksnmggspktavdhireilninqkrndyldiyaigvgkldvdwre
lnelgskkdgerhafilqdtkalhqvfehmldvskltdti

Timeline for d2i6qa1:

• d2i6qa1 first appeared in SCOPe 2.03
  
• d2i6qa1 appears in SCOPe 2.04
  
• d2i6qa1 appears in SCOPe 2.06
  
• d2i6qa1 appears in the current release, SCOPe 2.08