Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (6 families) |
Family c.62.1.0: automated matches [191586] (1 protein) not a true family |
Protein automated matches [191045] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188880] (10 PDB entries) |
Domain d2i6qa1: 2i6q A:224-442 [204721] Other proteins in same PDB: d2i6qa2, d2i6qa3 automated match to d1rrka2 complexed with mli, mn, nag |
PDB Entry: 2i6q (more details), 2.1 Å
SCOPe Domain Sequences for d2i6qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i6qa1 c.62.1.0 (A:224-442) automated matches {Human (Homo sapiens) [TaxId: 9606]} kiqiqrsghlnlyllldcsqsvsendflifkesaslmvdrifsfeinvsvaiitfasepk vlmsvlndnsrdmtevisslenanykdhengtgtntyaalnsvylmmnnqmrllgmetma wqeirhaiilltdgksnmggspktavdhireilninqkrndyldiyaigvgkldvdwrel nelgskkdgerhafilqdtkalhqvfehmldvskltdti
Timeline for d2i6qa1: