Lineage for d2i6qa1 (2i6q A:224-442)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892463Family c.62.1.0: automated matches [191586] (1 protein)
    not a true family
  6. 2892464Protein automated matches [191045] (3 species)
    not a true protein
  7. 2892467Species Human (Homo sapiens) [TaxId:9606] [188880] (10 PDB entries)
  8. 2892474Domain d2i6qa1: 2i6q A:224-442 [204721]
    Other proteins in same PDB: d2i6qa2, d2i6qa3
    automated match to d1rrka2
    complexed with mli, mn, nag

Details for d2i6qa1

PDB Entry: 2i6q (more details), 2.1 Å

PDB Description: complement component c2a
PDB Compounds: (A:) Complement C2a fragment

SCOPe Domain Sequences for d2i6qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i6qa1 c.62.1.0 (A:224-442) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kiqiqrsghlnlyllldcsqsvsendflifkesaslmvdrifsfeinvsvaiitfasepk
vlmsvlndnsrdmtevisslenanykdhengtgtntyaalnsvylmmnnqmrllgmetma
wqeirhaiilltdgksnmggspktavdhireilninqkrndyldiyaigvgkldvdwrel
nelgskkdgerhafilqdtkalhqvfehmldvskltdti

SCOPe Domain Coordinates for d2i6qa1:

Click to download the PDB-style file with coordinates for d2i6qa1.
(The format of our PDB-style files is described here.)

Timeline for d2i6qa1: