Lineage for d2i6fc_ (2i6f C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356043Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1356404Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1356405Protein automated matches [190131] (48 species)
    not a true protein
  7. 1356526Species Myxococcus xanthus [TaxId:34] [225234] (4 PDB entries)
  8. 1356532Domain d2i6fc_: 2i6f C: [204720]
    automated match to d2iynb_
    complexed with cl

Details for d2i6fc_

PDB Entry: 2i6f (more details), 1.9 Å

PDB Description: Receiver domain from Myxococcus xanthus social motility protein FrzS
PDB Compounds: (C:) Response regulator FrzS

SCOPe Domain Sequences for d2i6fc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i6fc_ c.23.1.0 (C:) automated matches {Myxococcus xanthus [TaxId: 34]}
kkilivesdtalsatlrsalegrgftvdettdgkgsveqirrdrpdlvvlavdlsagqng
ylicgklkkdddlknvpiviignpdgfaqhrklkahadeyvakpvdadqlveragali

SCOPe Domain Coordinates for d2i6fc_:

Click to download the PDB-style file with coordinates for d2i6fc_.
(The format of our PDB-style files is described here.)

Timeline for d2i6fc_: