Lineage for d2i6fa_ (2i6f A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856040Species Myxococcus xanthus [TaxId:34] [225234] (4 PDB entries)
  8. 2856044Domain d2i6fa_: 2i6f A: [204718]
    automated match to d2iynb_
    complexed with cl

Details for d2i6fa_

PDB Entry: 2i6f (more details), 1.9 Å

PDB Description: Receiver domain from Myxococcus xanthus social motility protein FrzS
PDB Compounds: (A:) Response regulator FrzS

SCOPe Domain Sequences for d2i6fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i6fa_ c.23.1.0 (A:) automated matches {Myxococcus xanthus [TaxId: 34]}
mskkilivesdtalsatlrsalegrgftvdettdgkgsveqirrdrpdlvvlavdlsagq
ngylicgklkkdddlknvpiviignpdgfaqhrklkahadeyvakpvdadqlveragali
gfpe

SCOPe Domain Coordinates for d2i6fa_:

Click to download the PDB-style file with coordinates for d2i6fa_.
(The format of our PDB-style files is described here.)

Timeline for d2i6fa_: