SCOPe 2.05: Domain d2i4wa_: 2i4w A:

Lineage for d2i4wa_ (2i4w A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (446 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d2i4wa_: 2i4w A: [204712]
   automated match to d3mimb_
   complexed with kgq

Details for d2i4wa_

PDB Entry: 2i4w, 1.55 Å

PDB Description: HIV-1 protease WT with GS-8374

PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d2i4wa_:

Sequence; same for both SEQRES and ATOM records:

>d2i4wa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigmtlnf

Timeline for d2i4wa_:

• d2i4wa_ first appeared in SCOPe 2.03
  
• d2i4wa_ appears in SCOPe 2.04
  
• d2i4wa_ appears in SCOPe 2.06
  
• d2i4wa_ appears in the current release, SCOPe 2.08