Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Anti bet v1 Fab BV16, (mouse), kappa L chain [48902] (1 PDB entry) |
Domain d1fski1: 1fsk I:1-118 [20471] Other proteins in same PDB: d1fska_, d1fskb2, d1fskc2, d1fskd_, d1fske2, d1fskf2, d1fskg_, d1fskh2, d1fski2, d1fskj_, d1fskk2, d1fskl2 |
PDB Entry: 1fsk (more details), 2.9 Å
SCOP Domain Sequences for d1fski1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fski1 b.1.1.1 (I:1-118) Immunoglobulin (variable domains of L and H chains) {Anti bet v1 Fab BV16, (mouse), kappa L chain} qvqlqqpgtelvrpgasvilsckasgytftsywinwvkqrpgqglewvgnifpsdsytny nqkfkdkatltvdkssstaymqvnsptsedsavyyctrgardtwfaywgqgtlvtvsv
Timeline for d1fski1: