Lineage for d1fski1 (1fsk I:6-118)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740220Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (181 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 2740431Domain d1fski1: 1fsk I:6-118 [20471]
    Other proteins in same PDB: d1fska_, d1fskb1, d1fskb2, d1fskc2, d1fskc3, d1fskd_, d1fske1, d1fske2, d1fskf2, d1fskf3, d1fskg_, d1fskh1, d1fskh2, d1fski2, d1fski3, d1fskj_, d1fskk1, d1fskk2, d1fskl2, d1fskl3
    part of anti-bet v1 Fab BV16

Details for d1fski1

PDB Entry: 1fsk (more details), 2.9 Å

PDB Description: complex formation between a fab fragment of a monoclonal igg antibody and the major allergen from birch pollen bet v 1
PDB Compounds: (I:) antibody heavy chain fab

SCOPe Domain Sequences for d1fski1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fski1 b.1.1.1 (I:6-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qpgtelvrpgasvilsckasgytftsywinwvkqrpgqglewvgnifpsdsytnynqkfk
dkatltvdkssstaymqvnsptsedsavyyctrgardtwfaywgqgtlvtvsv

SCOPe Domain Coordinates for d1fski1:

Click to download the PDB-style file with coordinates for d1fski1.
(The format of our PDB-style files is described here.)

Timeline for d1fski1: