Class b: All beta proteins [48724] (177 folds) |
Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies) consists of eight 4-stranded beta-sheet motifs; meander also found in some members of the WD40-repeat superfamily |
Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) automatically mapped to Pfam PF00930 |
Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins) Pfam PF00930 |
Protein automated matches [226889] (3 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [225089] (7 PDB entries) |
Domain d2i3za1: 2i3z A:38-509 [204698] Other proteins in same PDB: d2i3za2, d2i3zb2 automated match to d1orva1 complexed with lir |
PDB Entry: 2i3z (more details), 2.9 Å
SCOPe Domain Sequences for d2i3za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i3za1 b.70.3.1 (A:38-509) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} rrtytladylkntfrvksyslrwvsdseylykqennillfnaehgnssiflenstfeifg dsisdysvspdrlfvlleynyvkqwrhsytasysiydlnkrqliteekipnntqwitwsq eghklayvwkndiyvkiephlpshritstgkenvifngindwvyeeeifgaysalwwspn gtflayaqfndtgvplieysfysdeslqypktvwipypkagavnptvkffivntdslsst tttipmqitapasvttgdhylcdvawvsedrislqwlrriqnysvmaicdydkttlvwnc pttqehietsatgwcgrfrpaephftsdgssfykivsdkdgykhicqfqkdrkpeqvctf itkgawevisiealtsdylyyisneykempggrnlykiqltdhtnkkclscdlnpercqy ysvslskeakyyqlgcrgpglplytlhrstdqkelrvlednsaldkmlqdvq
Timeline for d2i3za1: