Lineage for d2i3za1 (2i3z A:38-509)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1803668Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 1803776Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 1803777Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
    Pfam PF00930
  6. 1804022Protein automated matches [226889] (2 species)
    not a true protein
  7. 1804030Species Norway rat (Rattus norvegicus) [TaxId:10116] [225089] (7 PDB entries)
  8. 1804039Domain d2i3za1: 2i3z A:38-509 [204698]
    Other proteins in same PDB: d2i3za2, d2i3zb2
    automated match to d1orva1
    complexed with lir

Details for d2i3za1

PDB Entry: 2i3z (more details), 2.9 Å

PDB Description: rat dpp-iv with xanthine mimetic inhibitor #7
PDB Compounds: (A:) Dipeptidyl peptidase 4 (Dipeptidyl peptidase IV) (DPP IV)

SCOPe Domain Sequences for d2i3za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i3za1 b.70.3.1 (A:38-509) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rrtytladylkntfrvksyslrwvsdseylykqennillfnaehgnssiflenstfeifg
dsisdysvspdrlfvlleynyvkqwrhsytasysiydlnkrqliteekipnntqwitwsq
eghklayvwkndiyvkiephlpshritstgkenvifngindwvyeeeifgaysalwwspn
gtflayaqfndtgvplieysfysdeslqypktvwipypkagavnptvkffivntdslsst
tttipmqitapasvttgdhylcdvawvsedrislqwlrriqnysvmaicdydkttlvwnc
pttqehietsatgwcgrfrpaephftsdgssfykivsdkdgykhicqfqkdrkpeqvctf
itkgawevisiealtsdylyyisneykempggrnlykiqltdhtnkkclscdlnpercqy
ysvslskeakyyqlgcrgpglplytlhrstdqkelrvlednsaldkmlqdvq

SCOPe Domain Coordinates for d2i3za1:

Click to download the PDB-style file with coordinates for d2i3za1.
(The format of our PDB-style files is described here.)

Timeline for d2i3za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i3za2