| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (16 species) not a true protein |
| Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [187220] (4 PDB entries) |
| Domain d2i24n_: 2i24 N: [204690] automated match to d2i25o_ complexed with cl |
PDB Entry: 2i24 (more details), 1.35 Å
SCOPe Domain Sequences for d2i24n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i24n_ b.1.1.1 (N:) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtpqritketgesltincvvrdsrcvlstgywyrkppgsrneesisdggryvetvnr
gsksfslrindltvkdsgtyrckpesrygsydavcaalndqygggtvvtvnaa
Timeline for d2i24n_: