Lineage for d2i24n1 (2i24 N:2-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2745421Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [187220] (4 PDB entries)
  8. 2745422Domain d2i24n1: 2i24 N:2-112 [204690]
    Other proteins in same PDB: d2i24n2
    automated match to d2i25o_
    complexed with cl

Details for d2i24n1

PDB Entry: 2i24 (more details), 1.35 Å

PDB Description: Crystal structure analysis of the nurse shark New Antigen Receptor PBLA8 variable domain
PDB Compounds: (N:) New Antigen Receptor PBLA8

SCOPe Domain Sequences for d2i24n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i24n1 b.1.1.1 (N:2-112) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtpqritketgesltincvvrdsrcvlstgywyrkppgsrneesisdggryvetvnr
gsksfslrindltvkdsgtyrckpesrygsydavcaalndqygggtvvtvn

SCOPe Domain Coordinates for d2i24n1:

Click to download the PDB-style file with coordinates for d2i24n1.
(The format of our PDB-style files is described here.)

Timeline for d2i24n1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i24n2