Lineage for d1fskf1 (1fsk F:1-118)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287638Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1288122Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (177 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 1288329Domain d1fskf1: 1fsk F:1-118 [20469]
    Other proteins in same PDB: d1fska_, d1fskb1, d1fskb2, d1fskc2, d1fskd_, d1fske1, d1fske2, d1fskf2, d1fskg_, d1fskh1, d1fskh2, d1fski2, d1fskj_, d1fskk1, d1fskk2, d1fskl2
    part of anti-bet v1 Fab BV16

Details for d1fskf1

PDB Entry: 1fsk (more details), 2.9 Å

PDB Description: complex formation between a fab fragment of a monoclonal igg antibody and the major allergen from birch pollen bet v 1
PDB Compounds: (F:) antibody heavy chain fab

SCOPe Domain Sequences for d1fskf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fskf1 b.1.1.1 (F:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqpgtelvrpgasvilsckasgytftsywinwvkqrpgqglewvgnifpsdsytny
nqkfkdkatltvdkssstaymqvnsptsedsavyyctrgardtwfaywgqgtlvtvsv

SCOPe Domain Coordinates for d1fskf1:

Click to download the PDB-style file with coordinates for d1fskf1.
(The format of our PDB-style files is described here.)

Timeline for d1fskf1: