Lineage for d2i22d_ (2i22 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908082Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2908083Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2908303Family c.80.1.0: automated matches [191405] (1 protein)
    not a true family
  6. 2908304Protein automated matches [190547] (18 species)
    not a true protein
  7. 2908358Species Escherichia coli [TaxId:562] [226782] (2 PDB entries)
  8. 2908366Domain d2i22d_: 2i22 D: [204689]
    automated match to d2xblb_
    complexed with i22

Details for d2i22d_

PDB Entry: 2i22 (more details), 2.8 Å

PDB Description: Crystal structure of Escherichia coli phosphoheptose isomerase in complex with reaction substrate sedoheptulose 7-phosphate
PDB Compounds: (D:) Phosphoheptose isomerase

SCOPe Domain Sequences for d2i22d_:

Sequence, based on SEQRES records: (download)

>d2i22d_ c.80.1.0 (D:) automated matches {Escherichia coli [TaxId: 562]}
myqdlirnelneaaetlanflkddanihaiqraavlladsfkaggkvlscgnggshcdam
hfaeeltgryrenrpgypaiaisdvshiscvgndfgfndifsryveavgregdvllgist
sgnsanvikaiaaarekgmkvitltgkdggkmagtadieirvphfgyadriqeihikvih
iliqliekemvk

Sequence, based on observed residues (ATOM records): (download)

>d2i22d_ c.80.1.0 (D:) automated matches {Escherichia coli [TaxId: 562]}
myqdlirnelneaaetlanflkddanihaiqraavlladsfkaggkvlscgnggshcdam
hfaeeltgryrenrpgypaiaisndifsryveavgregdvllgistsgnsanvikaiaaa
rekgmkvitltgkdggkmagtadieirvphfgyadriqeihikvihiliqliekemvk

SCOPe Domain Coordinates for d2i22d_:

Click to download the PDB-style file with coordinates for d2i22d_.
(The format of our PDB-style files is described here.)

Timeline for d2i22d_: