Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
Superfamily c.80.1: SIS domain [53697] (4 families) |
Family c.80.1.0: automated matches [191405] (1 protein) not a true family |
Protein automated matches [190547] (18 species) not a true protein |
Species Escherichia coli [TaxId:562] [226782] (2 PDB entries) |
Domain d2i22c_: 2i22 C: [204688] automated match to d2xblb_ complexed with i22 |
PDB Entry: 2i22 (more details), 2.8 Å
SCOPe Domain Sequences for d2i22c_:
Sequence, based on SEQRES records: (download)
>d2i22c_ c.80.1.0 (C:) automated matches {Escherichia coli [TaxId: 562]} myqdlirnelneaaetlanflkddanihaiqraavlladsfkaggkvlscgnggshcdam hfaeeltgryrenrpgypaiaisdvshiscvgndfgfndifsryveavgregdvllgist sgnsanvikaiaaarekgmkvitltgkdggkmagtadieirvphfgyadriqeihikvih iliqliekemvk
>d2i22c_ c.80.1.0 (C:) automated matches {Escherichia coli [TaxId: 562]} myqdlirnelneaaetlanflkddanihaiqraavlladsfkaggkvlscgnggshcdam hfaeeltgryrenrpgypaiaisndifsryveavgregdvllgistsgnsanvikaiaaa rekgmkvitltgkdggkmagtadieirvphfgyadriqeihikvihiliqliekemvk
Timeline for d2i22c_: