SCOPe 2.08: Domain d2i22c_: 2i22 C:

Lineage for d2i22c_ (2i22 C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (4 families)

5. Family c.80.1.0: automated matches [191405] (1 protein)
   not a true family

6. Protein automated matches [190547] (18 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [226782] (2 PDB entries)

8. Domain d2i22c_: 2i22 C: [204688]
   automated match to d2xblb_
   complexed with i22

Details for d2i22c_

PDB Entry: 2i22, 2.8 Å

PDB Description: Crystal structure of Escherichia coli phosphoheptose isomerase in complex with reaction substrate sedoheptulose 7-phosphate

PDB Compounds: (C:) Phosphoheptose isomerase

SCOPe Domain Sequences for d2i22c_:

Sequence, based on SEQRES records:

>d2i22c_ c.80.1.0 (C:) automated matches {Escherichia coli [TaxId: 562]}
myqdlirnelneaaetlanflkddanihaiqraavlladsfkaggkvlscgnggshcdam
hfaeeltgryrenrpgypaiaisdvshiscvgndfgfndifsryveavgregdvllgist
sgnsanvikaiaaarekgmkvitltgkdggkmagtadieirvphfgyadriqeihikvih
iliqliekemvk

Sequence, based on observed residues (ATOM records):

>d2i22c_ c.80.1.0 (C:) automated matches {Escherichia coli [TaxId: 562]}
myqdlirnelneaaetlanflkddanihaiqraavlladsfkaggkvlscgnggshcdam
hfaeeltgryrenrpgypaiaisndifsryveavgregdvllgistsgnsanvikaiaaa
rekgmkvitltgkdggkmagtadieirvphfgyadriqeihikvihiliqliekemvk

Timeline for d2i22c_:

• d2i22c_ first appeared in SCOPe 2.03
  
• d2i22c_ appears in SCOPe 2.07