SCOPe 2.03: Domain d2i1na_: 2i1n A:

Lineage for d2i1na_ (2i1n A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (44 PDB entries)

8. Domain d2i1na_: 2i1n A: [204680]
   automated match to d1x5qa1
   complexed with na

Details for d2i1na_

PDB Entry: 2i1n, 1.85 Å

PDB Description: Crystal structure of the 1st PDZ domain of Human DLG3

PDB Compounds: (A:) Discs, large homolog 3

SCOPe Domain Sequences for d2i1na_:

Sequence; same for both SEQRES and ATOM records:

>d2i1na_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mfkyeeivlergnsglgfsiaggidnphvpddpgifitkiipggaaamdgrlgvndcvlr
vnevdvsevvhsravealkeagpvvrlvvrrrqpppeetsv

Timeline for d2i1na_:

• d2i1na_ is new in SCOPe 2.03-stable
  
• d2i1na_ appears in SCOPe 2.04
  
• d2i1na_ appears in the current release, SCOPe 2.08, called d2i1na1