SCOPe 2.08: Domain d2i0ma_: 2i0m A:

Lineage for d2i0ma_ (2i0m A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.12: PhoU-like [109755] (2 families)
   duplication: consists of two sequence each repeats adopting this fold

5. Family a.7.12.0: automated matches [227189] (1 protein)
   not a true family

6. Protein automated matches [226911] (2 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:170187] [225141] (1 PDB entry)

8. Domain d2i0ma_: 2i0m A: [204679]
   automated match to d1xwma_
   complexed with zn

Details for d2i0ma_

PDB Entry: 2i0m, 2.4 Å

PDB Description: Crystal structure of the phosphate transport system regulatory protein PhoU from Streptococcus pneumoniae

PDB Compounds: (A:) Phosphate transport system protein phoU

SCOPe Domain Sequences for d2i0ma_:

Sequence, based on SEQRES records:

>d2i0ma_ a.7.12.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
qfdlelheleqsflglgqlvletaskallalaskdkemaeliinkdhainqgqsaieltc
arllalqqpqvsdlrfvisimsscsdlermgdhmagiakavlqlkenqlapdeeqlhqmg
klslsmladllvafplhqaskaisiaqkdeqidqyyyalskeiiglmkdqetsipngtqy
lyiighlerfadyianicerlvyletgelvdl

Sequence, based on observed residues (ATOM records):

>d2i0ma_ a.7.12.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
qfdlelheleqsflglgqlvletaskallalaskdkemaeliinkdhainqgqsaieltc
arllalpqvsdlrfvisimsscsdlermgdhmagiakavlqlkenqlaeeqlhqmgklsl
smladllvafplhqaskaisiaqkdeqidqyyyalskeiiglmkdqesipngtqylyiig
hlerfadyianicerlvyletgelvdl

Timeline for d2i0ma_:

• d2i0ma_ first appeared in SCOPe 2.03
  
• d2i0ma_ appears in SCOPe 2.07