![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.12: PhoU-like [109755] (2 families) ![]() duplication: consists of two sequence each repeats adopting this fold |
![]() | Family a.7.12.0: automated matches [227189] (1 protein) not a true family |
![]() | Protein automated matches [226911] (2 species) not a true protein |
![]() | Species Streptococcus pneumoniae [TaxId:170187] [225141] (1 PDB entry) |
![]() | Domain d2i0ma_: 2i0m A: [204679] automated match to d1xwma_ complexed with zn |
PDB Entry: 2i0m (more details), 2.4 Å
SCOPe Domain Sequences for d2i0ma_:
Sequence, based on SEQRES records: (download)
>d2i0ma_ a.7.12.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]} qfdlelheleqsflglgqlvletaskallalaskdkemaeliinkdhainqgqsaieltc arllalqqpqvsdlrfvisimsscsdlermgdhmagiakavlqlkenqlapdeeqlhqmg klslsmladllvafplhqaskaisiaqkdeqidqyyyalskeiiglmkdqetsipngtqy lyiighlerfadyianicerlvyletgelvdl
>d2i0ma_ a.7.12.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]} qfdlelheleqsflglgqlvletaskallalaskdkemaeliinkdhainqgqsaieltc arllalpqvsdlrfvisimsscsdlermgdhmagiakavlqlkenqlaeeqlhqmgklsl smladllvafplhqaskaisiaqkdeqidqyyyalskeiiglmkdqesipngtqylyiig hlerfadyianicerlvyletgelvdl
Timeline for d2i0ma_: