Lineage for d2i08a_ (2i08 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2710608Protein Calmodulin [47516] (13 species)
  7. 2710701Species Human (Homo sapiens) [TaxId:9606] [47517] (123 PDB entries)
    Uniprot P02593
  8. 2710741Domain d2i08a_: 2i08 A: [204673]
    automated match to d2ctna_
    complexed with ca, gol; mutant

    fragment; missing more than one-third of the common structure and/or sequence

Details for d2i08a_

PDB Entry: 2i08 (more details), 2 Å

PDB Description: solvation effect in conformational changes of ef-hand proteins: x-ray structure of ca2+-saturated double mutant q41l-k75i of n-domain of calmodulin
PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d2i08a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i08a_ a.39.1.5 (A:) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}
qlteeqiaefkeafslydkdgdgtittkelgtvmrslglnpteaelqdminevdadgngt
idfpefltmmarim

SCOPe Domain Coordinates for d2i08a_:

Click to download the PDB-style file with coordinates for d2i08a_.
(The format of our PDB-style files is described here.)

Timeline for d2i08a_: