![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Abelsone tyrosine kinase (abl) [56166] (2 species) PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226825] (5 PDB entries) |
![]() | Domain d2hz4b1: 2hz4 B:246-498 [204669] Other proteins in same PDB: d2hz4b2 automated match to d2e2ba_ complexed with 4st |
PDB Entry: 2hz4 (more details), 2.8 Å
SCOPe Domain Sequences for d2hz4b1:
Sequence, based on SEQRES records: (download)
>d2hz4b1 d.144.1.7 (B:246-498) Abelsone tyrosine kinase (abl) {Human (Homo sapiens) [TaxId: 9606]} hklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmkeikhpnlvqllgvc treppfyiitefmtygnlldylrecnrqevnavvllymatqissameylekknfihrdla arnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkfsiksdvwaf gvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnpsdrps faeihqafetmfq
>d2hz4b1 d.144.1.7 (B:246-498) Abelsone tyrosine kinase (abl) {Human (Homo sapiens) [TaxId: 9606]} hklgevyegvwkkysltvavktlkedtmeveeflkeaavmkeikhpnlvqllgvctrepp fyiitefmtygnlldylrecnrqevnavvllymatqissameylekknfihrdlaarncl vgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkfsiksdvwafgvllw eiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnpsdrpsfaeih qafetmfq
Timeline for d2hz4b1: