Lineage for d2hz4b1 (2hz4 B:246-498)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2542346Protein Abelsone tyrosine kinase (abl) [56166] (2 species)
    PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase
  7. 2542347Species Human (Homo sapiens) [TaxId:9606] [226825] (5 PDB entries)
  8. 2542358Domain d2hz4b1: 2hz4 B:246-498 [204669]
    Other proteins in same PDB: d2hz4b2
    automated match to d2e2ba_
    complexed with 4st

Details for d2hz4b1

PDB Entry: 2hz4 (more details), 2.8 Å

PDB Description: abl kinase domain unligated and in complex with tetrahydrostaurosporine
PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d2hz4b1:

Sequence, based on SEQRES records: (download)

>d2hz4b1 d.144.1.7 (B:246-498) Abelsone tyrosine kinase (abl) {Human (Homo sapiens) [TaxId: 9606]}
hklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmkeikhpnlvqllgvc
treppfyiitefmtygnlldylrecnrqevnavvllymatqissameylekknfihrdla
arnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkfsiksdvwaf
gvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnpsdrps
faeihqafetmfq

Sequence, based on observed residues (ATOM records): (download)

>d2hz4b1 d.144.1.7 (B:246-498) Abelsone tyrosine kinase (abl) {Human (Homo sapiens) [TaxId: 9606]}
hklgevyegvwkkysltvavktlkedtmeveeflkeaavmkeikhpnlvqllgvctrepp
fyiitefmtygnlldylrecnrqevnavvllymatqissameylekknfihrdlaarncl
vgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkfsiksdvwafgvllw
eiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnpsdrpsfaeih
qafetmfq

SCOPe Domain Coordinates for d2hz4b1:

Click to download the PDB-style file with coordinates for d2hz4b1.
(The format of our PDB-style files is described here.)

Timeline for d2hz4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hz4b2