SCOPe 2.06: Domain d2hz4a_: 2hz4 A:

Lineage for d2hz4a_ (2hz4 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Abelsone tyrosine kinase (abl) [56166] (2 species)
   PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [226825] (5 PDB entries)

8. Domain d2hz4a_: 2hz4 A: [204668]
   Other proteins in same PDB: d2hz4b2
   automated match to d2e2ba_
   complexed with 4st

Details for d2hz4a_

PDB Entry: 2hz4, 2.8 Å

PDB Description: abl kinase domain unligated and in complex with tetrahydrostaurosporine

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d2hz4a_:

Sequence, based on SEQRES records:

>d2hz4a_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Human (Homo sapiens) [TaxId: 9606]}
kwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmkei
khpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissamey
lekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslay
nkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmr
acwqwnpsdrpsfaeihqafetmfqes

Sequence, based on observed residues (ATOM records):

>d2hz4a_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Human (Homo sapiens) [TaxId: 9606]}
kwemertditmkhklgevyegvwkkysltvavktlkedtmeveeflkeaavmkeikhpnl
vqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissameylekkn
fihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkfsi
ksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqw
npsdrpsfaeihqafetmfqes

Timeline for d2hz4a_:

• d2hz4a_ first appeared in SCOPe 2.03
  
• d2hz4a_ appears in SCOPe 2.05
  
• d2hz4a_ appears in SCOPe 2.07
  
• d2hz4a_ appears in the current release, SCOPe 2.08