Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Abelsone tyrosine kinase (abl) [56166] (2 species) PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [226825] (5 PDB entries) |
Domain d2hz0a_: 2hz0 A: [204666] automated match to d2e2ba_ complexed with gin |
PDB Entry: 2hz0 (more details), 2.1 Å
SCOPe Domain Sequences for d2hz0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hz0a_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Human (Homo sapiens) [TaxId: 9606]} dkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmke ikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissame ylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesla ynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelm racwqwnpsdrpsfaeihqafetmf
Timeline for d2hz0a_: