Lineage for d2hz0a_ (2hz0 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1929262Protein Abelsone tyrosine kinase (abl) [56166] (2 species)
    PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase
  7. 1929263Species Human (Homo sapiens) [TaxId:9606] [226825] (5 PDB entries)
  8. 1929266Domain d2hz0a_: 2hz0 A: [204666]
    automated match to d2e2ba_
    complexed with gin

Details for d2hz0a_

PDB Entry: 2hz0 (more details), 2.1 Å

PDB Description: abl kinase domain in complex with nvp-aeg082
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d2hz0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hz0a_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Human (Homo sapiens) [TaxId: 9606]}
dkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmke
ikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissame
ylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesla
ynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelm
racwqwnpsdrpsfaeihqafetmf

SCOPe Domain Coordinates for d2hz0a_:

Click to download the PDB-style file with coordinates for d2hz0a_.
(The format of our PDB-style files is described here.)

Timeline for d2hz0a_: