Lineage for d2hyyc1 (2hyy C:246-498)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2979723Protein Abelsone tyrosine kinase (abl) [56166] (2 species)
    PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase
  7. 2979724Species Human (Homo sapiens) [TaxId:9606] [226825] (5 PDB entries)
  8. 2979732Domain d2hyyc1: 2hyy C:246-498 [204664]
    Other proteins in same PDB: d2hyyb2, d2hyyc2, d2hyyd2
    automated match to d2e2ba_
    complexed with sti

Details for d2hyyc1

PDB Entry: 2hyy (more details), 2.4 Å

PDB Description: human abl kinase domain in complex with imatinib (sti571, glivec)
PDB Compounds: (C:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d2hyyc1:

Sequence, based on SEQRES records: (download)

>d2hyyc1 d.144.1.7 (C:246-498) Abelsone tyrosine kinase (abl) {Human (Homo sapiens) [TaxId: 9606]}
hklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmkeikhpnlvqllgvc
treppfyiitefmtygnlldylrecnrqevnavvllymatqissameylekknfihrdla
arnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkfsiksdvwaf
gvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnpsdrps
faeihqafetmfq

Sequence, based on observed residues (ATOM records): (download)

>d2hyyc1 d.144.1.7 (C:246-498) Abelsone tyrosine kinase (abl) {Human (Homo sapiens) [TaxId: 9606]}
hklgggqygevyegvwkkysltvavktlketmeveeflkeaavmkeikhpnlvqllgvct
reppfyiitefmtygnlldylrecnrqevnavvllymatqissameylekknfihrdlaa
rnclvgenhlvkvadfglsrlmtytahagakfpikwtapeslaynkfsiksdvwafgvll
weiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnpsdrpsfaei
hqafetmfq

SCOPe Domain Coordinates for d2hyyc1:

Click to download the PDB-style file with coordinates for d2hyyc1.
(The format of our PDB-style files is described here.)

Timeline for d2hyyc1: