Lineage for d2hywb_ (2hyw B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717085Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2717086Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2717205Family a.65.1.0: automated matches [191494] (1 protein)
    not a true family
  6. 2717206Protein automated matches [190800] (2 species)
    not a true protein
  7. 2717207Species Human (Homo sapiens) [TaxId:9606] [188064] (6 PDB entries)
  8. 2717212Domain d2hywb_: 2hyw B: [204661]
    automated match to d2zhia_
    complexed with ca

Details for d2hywb_

PDB Entry: 2hyw (more details), 2.1 Å

PDB Description: human annexin a2 with calcium bound
PDB Compounds: (B:) annexin a2

SCOPe Domain Sequences for d2hywb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hywb_ a.65.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfdaerdalnietaiktkgvdevtivniltnrsnaqrqdiafayqrrtkkelasalksal
sghletvilgllktpaqydaselkasmkglgtdedslieiicsrtnqelqeinrvykemy
ktdlekdiisdtsgdfrklmvalakgrraedgsvidyelidqdardlydagvkrkgtdvp
kwisimtersvphlqkvfdryksyspydmlesirkevkgdlenaflnlvqciqnkplyfa
drlydsmkgkgtrdkvlirimvsrsevdmlkirsefkrkygkslyyyiqqdtkgdyqkal
lylcggdd

SCOPe Domain Coordinates for d2hywb_:

Click to download the PDB-style file with coordinates for d2hywb_.
(The format of our PDB-style files is described here.)

Timeline for d2hywb_: