Lineage for d2hyva_ (2hyv A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717085Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2717086Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2717205Family a.65.1.0: automated matches [191494] (1 protein)
    not a true family
  6. 2717206Protein automated matches [190800] (2 species)
    not a true protein
  7. 2717207Species Human (Homo sapiens) [TaxId:9606] [188064] (6 PDB entries)
  8. 2717208Domain d2hyva_: 2hyv A: [204659]
    automated match to d2zhia_
    complexed with ca

Details for d2hyva_

PDB Entry: 2hyv (more details), 1.42 Å

PDB Description: human annexin a2 with heparin hexasaccharide bound
PDB Compounds: (A:) annexin a2

SCOPe Domain Sequences for d2hyva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hyva_ a.65.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfdaerdalnietaiktkgvdevtivniltnrsnaqrqdiafayqrrtkkelasalksal
sghletvilgllktpaqydaselkasmkglgtdedslieiicsrtnqelqeinrvykemy
ktdlekdiisdtsgdfrklmvalakgrraedgsvidyelidqdardlydagvkrkgtdvp
kwisimtersvphlqkvfdryksyspydmlesirkevkgdlenaflnlvqciqnkplyfa
drlydsmkgkgtrdkvlirimvsrsevdmlkirsefkrkygkslyyyiqqdtkgdyqkal
lylcggdd

SCOPe Domain Coordinates for d2hyva_:

Click to download the PDB-style file with coordinates for d2hyva_.
(The format of our PDB-style files is described here.)

Timeline for d2hyva_: