Lineage for d2hyua_ (2hyu A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000010Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2000011Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2000122Family a.65.1.0: automated matches [191494] (1 protein)
    not a true family
  6. 2000123Protein automated matches [190800] (1 species)
    not a true protein
  7. 2000124Species Human (Homo sapiens) [TaxId:9606] [188064] (5 PDB entries)
  8. 2000126Domain d2hyua_: 2hyu A: [204658]
    automated match to d2zhia_
    complexed with ca

Details for d2hyua_

PDB Entry: 2hyu (more details), 1.86 Å

PDB Description: human annexin a2 with heparin tetrasaccharide bound
PDB Compounds: (A:) annexin a2

SCOPe Domain Sequences for d2hyua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hyua_ a.65.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfdaerdalnietaiktkgvdevtivniltnrsnaqrqdiafayqrrtkkelasalksal
sghletvilgllktpaqydaselkasmkglgtdedslieiicsrtnqelqeinrvykemy
ktdlekdiisdtsgdfrklmvalakgrraedgsvidyelidqdardlydagvkrkgtdvp
kwisimtersvphlqkvfdryksyspydmlesirkevkgdlenaflnlvqciqnkplyfa
drlydsmkgkgtrdkvlirimvsrsevdmlkirsefkrkygkslyyyiqqdtkgdyqkal
lylcggdd

SCOPe Domain Coordinates for d2hyua_:

Click to download the PDB-style file with coordinates for d2hyua_.
(The format of our PDB-style files is described here.)

Timeline for d2hyua_: