Lineage for d2hwmb1 (2hwm B:1G-137)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401197Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2401198Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 2401199Protein Acidic FGF (FGF1) [50357] (4 species)
  7. 2401213Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
    Uniprot P05230 16-152 ! Uniprot P05230
  8. 2401226Domain d2hwmb1: 2hwm B:1G-137 [204650]
    Other proteins in same PDB: d2hwma2, d2hwmb2
    automated match to d1q03a_
    complexed with fmt; mutant

Details for d2hwmb1

PDB Entry: 2hwm (more details), 1.6 Å

PDB Description: crystal structure of lys12val/cys117val mutant of human acidic fibroblast growth factor at 1.60 angstrom resolution
PDB Compounds: (B:) heparin-binding growth factor 1

SCOPe Domain Sequences for d2hwmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hwmb1 b.42.1.1 (B:1G-137) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
fnlppgnykkpvllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikste
tgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsvkrg
prthygqkailflplpv

SCOPe Domain Coordinates for d2hwmb1:

Click to download the PDB-style file with coordinates for d2hwmb1.
(The format of our PDB-style files is described here.)

Timeline for d2hwmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hwmb2