SCOP 1.71: Domain d1fh5h1: 1fh5 H:4-120

Lineage for d1fh5h1 (1fh5 H:4-120)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (49 PDB entries)

8. Domain d1fh5h1: 1fh5 H:4-120 [20465]
   Other proteins in same PDB: d1fh5h2, d1fh5l1, d1fh5l2
   part of Fab MAK33; conflict: annotated in PDB as human protein

Details for d1fh5h1

PDB Entry: 1fh5, 2.9 Å

PDB Description: crystal structure of the fab fragment of the monoclonal antibody mak33

SCOP Domain Sequences for d1fh5h1:

Sequence; same for both SEQRES and ATOM records:

>d1fh5h1 b.1.1.1 (H:4-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2}
sggglvkpagslklscaasgftfssyymywvrqtpdkrlewvatisdggsytyypdsvkg
rftisrdnaknnlylqmsslksedtamyycardamdywgqgtlvtvsa

Timeline for d1fh5h1:

• d1fh5h1 first appeared (with stable ids) in SCOP 1.55
  
• d1fh5h1 appears in SCOP 1.69
  
• d1fh5h1 appears in SCOP 1.73
  
• d1fh5h1 appears in the current release, SCOPe 2.08