SCOPe 2.03: Domain d2hwma_: 2hwm A:

Lineage for d2hwma_ (2hwm A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (78 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d2hwma_: 2hwm A: [204649]
   automated match to d1q03a_
   complexed with fmt; mutant

Details for d2hwma_

PDB Entry: 2hwm, 1.6 Å

PDB Description: crystal structure of lys12val/cys117val mutant of human acidic fibroblast growth factor at 1.60 angstrom resolution

PDB Compounds: (A:) heparin-binding growth factor 1

SCOPe Domain Sequences for d2hwma_:

Sequence; same for both SEQRES and ATOM records:

>d2hwma_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
hhhhfnlppgnykkpvllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
kstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngs
vkrgprthygqkailflplpv

Timeline for d2hwma_:

• d2hwma_ is new in SCOPe 2.03-stable
  
• d2hwma_ appears in SCOPe 2.04
  
• d2hwma_ appears in the current release, SCOPe 2.08, called d2hwma1