Lineage for d2hw5b_ (2hw5 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853061Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2853276Protein automated matches [190669] (6 species)
    not a true protein
  7. 2853291Species Human (Homo sapiens) [TaxId:9606] [187771] (5 PDB entries)
  8. 2853299Domain d2hw5b_: 2hw5 B: [204637]
    automated match to d2duba_
    complexed with coo, mg

Details for d2hw5b_

PDB Entry: 2hw5 (more details), 2.55 Å

PDB Description: The crystal structure of human enoyl-coenzyme A (CoA) hydratase short chain 1, ECHS1
PDB Compounds: (B:) enoyl-coa hydratase

SCOPe Domain Sequences for d2hw5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hw5b_ c.14.1.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
anfeyiiaekrgknntvgliqlnrpkalnalcdglidelnqalkifeedpavgaivltgg
dkafaagadikemqnlsfqdcysskflkhwdhltqvkkpviaavngyafgggcelammcd
iiyagekaqfaqpeiligtipgaggtqrltravgkslamemvltgdrisaqdakqaglvs
kicpvetlveeaiqcaekiasnskivvamakesvnaafemtltegsklekklfystfatd
drkegmtafvekrkanfkdq

SCOPe Domain Coordinates for d2hw5b_:

Click to download the PDB-style file with coordinates for d2hw5b_.
(The format of our PDB-style files is described here.)

Timeline for d2hw5b_: