SCOPe 2.03: Domain d2hw5a_: 2hw5 A:

Lineage for d2hw5a_ (2hw5 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.3: Crotonase-like [52103] (14 proteins)

6. Protein automated matches [190669] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187771] (2 PDB entries)

8. Domain d2hw5a_: 2hw5 A: [204636]
   automated match to d2duba_
   complexed with coo, mg

Details for d2hw5a_

PDB Entry: 2hw5, 2.55 Å

PDB Description: The crystal structure of human enoyl-coenzyme A (CoA) hydratase short chain 1, ECHS1

PDB Compounds: (A:) enoyl-coa hydratase

SCOPe Domain Sequences for d2hw5a_:

Sequence; same for both SEQRES and ATOM records:

>d2hw5a_ c.14.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
anfeyiiaekrgknntvgliqlnrpkalnalcdglidelnqalkifeedpavgaivltgg
dkafaagadikemqnlsfqdcysskflkhwdhltqvkkpviaavngyafgggcelammcd
iiyagekaqfaqpeiligtipgaggtqrltravgkslamemvltgdrisaqdakqaglvs
kicpvetlveeaiqcaekiasnskivvamakesvnaafemtltegsklekklfystfatd
drkegmtafvekrkanfkdq

Timeline for d2hw5a_:

• d2hw5a_ is new in SCOPe 2.03-stable
  
• d2hw5a_ appears in SCOPe 2.04
  
• d2hw5a_ appears in the current release, SCOPe 2.08