SCOPe 2.08: Domain d2hupb_: 2hup B:

Lineage for d2hupb_ (2hup B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)

8. Domain d2hupb_: 2hup B: [204635]
   automated match to d1x3sa1
   complexed with gdp, mg, unx

Details for d2hupb_

PDB Entry: 2hup, 2.05 Å

PDB Description: crystal structure of human rab43 in complex with gdp

PDB Compounds: (B:) RAS-related protein RAB-43

SCOPe Domain Sequences for d2hupb_:

Sequence, based on SEQRES records:

>d2hupb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ydflfklvlvgdasvgktcvvqrfktgafserqgstigvdftmktleiqgkrvklqiwdt
agqerfrtitqsyyrsangailayditkrssflsvphwiedvrkyagsnivqllignksd
lselrevslaeaqslaehydilcaietsakdssnveeaflrvatelimrh

Sequence, based on observed residues (ATOM records):

>d2hupb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ydflfklvlvgdasvgktcvvqrfktgafdftmktleirvklqiwdtagqerfrtitqsy
yrsangailayditkrssflsvphwiedvrkyagsnivqllignksdlselrevslaeaq
slaehydilcaietsakdssnveeaflrvatelimrh

Timeline for d2hupb_:

• d2hupb_ first appeared in SCOPe 2.03
  
• d2hupb_ appears in SCOPe 2.07