Lineage for d2hqeb_ (2hqe B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394116Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2394117Family b.34.9.1: Tudor domain [63749] (8 proteins)
    Pfam PF00567
  6. 2394145Protein P100 co-activator, SND1 [141207] (1 species)
  7. 2394146Species Human (Homo sapiens) [TaxId:9606] [141208] (3 PDB entries)
    Uniprot Q7KZF4 705-794
  8. 2394149Domain d2hqeb_: 2hqe B: [204633]
    automated match to d2hqxa1

Details for d2hqeb_

PDB Entry: 2hqe (more details), 2 Å

PDB Description: Crystal structure of human P100 Tudor domain: Large fragment
PDB Compounds: (B:) p100 co-activator tudor domain

SCOPe Domain Sequences for d2hqeb_:

Sequence, based on SEQRES records: (download)

>d2hqeb_ b.34.9.1 (B:) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]}
tqfqklmenmrndiashppvegsyaprrgefciakfvdgewyrarvekvespakihvfyi
dygnrevlpstrlgtlspafstrvlpaqate

Sequence, based on observed residues (ATOM records): (download)

>d2hqeb_ b.34.9.1 (B:) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]}
tqfqklmenmrndiashppyaprrgefciakfvdgewyrarvekvespakihvfyidygn
revlpstrlgtlspafstrvlpaqate

SCOPe Domain Coordinates for d2hqeb_:

Click to download the PDB-style file with coordinates for d2hqeb_.
(The format of our PDB-style files is described here.)

Timeline for d2hqeb_: