Lineage for d2hq6a1 (2hq6 A:8-172)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397365Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2397366Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2397776Family b.62.1.0: automated matches [191372] (1 protein)
    not a true family
  6. 2397777Protein automated matches [190450] (5 species)
    not a true protein
  7. 2397788Species Human (Homo sapiens) [TaxId:9606] [225106] (2 PDB entries)
  8. 2397789Domain d2hq6a1: 2hq6 A:8-172 [204632]
    Other proteins in same PDB: d2hq6a2
    automated match to d2x7ka_
    complexed with gol, iod

Details for d2hq6a1

PDB Entry: 2hq6 (more details), 1.75 Å

PDB Description: structure of the cyclophilin_cecyp16-like domain of the serologically defined colon cancer antigen 10 from homo sapiens
PDB Compounds: (A:) Serologically defined colon cancer antigen 10

SCOPe Domain Sequences for d2hq6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hq6a1 b.62.1.0 (A:8-172) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epptngkvllkttagdidielwskeapkacrnfiqlcleayydntifhrvvpgfivqggd
ptgtgsggesiygapfkdefhsrlrfnrrglvamanagshdngsqffftlgradelnnkh
tifgkvtgdtvynmlrlsevdiddderphnphkikscevlfnpfd

SCOPe Domain Coordinates for d2hq6a1:

Click to download the PDB-style file with coordinates for d2hq6a1.
(The format of our PDB-style files is described here.)

Timeline for d2hq6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hq6a2