Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (30 species) not a true protein |
Species Human immunodeficiency virus 1 [TaxId:11676] [225129] (15 PDB entries) |
Domain d2hnda2: 2hnd A:430-537 [204627] Other proteins in same PDB: d2hnda1, d2hndb_ automated match to d1vrta1 complexed with mg, nvp, po4; mutant |
PDB Entry: 2hnd (more details), 2.5 Å
SCOPe Domain Sequences for d2hnda2:
Sequence, based on SEQRES records: (download)
>d2hnda2 c.55.3.0 (A:430-537) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvp
>d2hnda2 c.55.3.0 (A:430-537) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} ekepivgaetfyvdagyvtnrgrqkvvtltdttnqktelqaiylalqdsglevnivtdsq yalgiiqaqpdqseselvnqiieqlikkekvylawvp
Timeline for d2hnda2: