Lineage for d2hlsb1 (2hls B:3-123)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2878971Species Aeropyrum pernix [TaxId:272557] [225140] (1 PDB entry)
  8. 2878974Domain d2hlsb1: 2hls B:3-123 [204624]
    automated match to d1j08a1
    complexed with cl

Details for d2hlsb1

PDB Entry: 2hls (more details), 1.93 Å

PDB Description: The crystal structure of a protein disulfide oxidoreductase from Aeropyrum pernix k1
PDB Compounds: (B:) protein disulfide oxidoreductase

SCOPe Domain Sequences for d2hlsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hlsb1 c.47.1.0 (B:3-123) automated matches {Aeropyrum pernix [TaxId: 272557]}
ryyvldlsedfrrelretlaemvnpvevhvflsksgcetcedtlrlmklfeeesptrngg
kllklnvyyresdsdkfsefkvervptvaflggevrwtgipageeiralvevimrlsede
s

SCOPe Domain Coordinates for d2hlsb1:

Click to download the PDB-style file with coordinates for d2hlsb1.
(The format of our PDB-style files is described here.)

Timeline for d2hlsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hlsb2