Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Aeropyrum pernix [TaxId:272557] [225140] (1 PDB entry) |
Domain d2hlsa1: 2hls A:2-123 [204622] automated match to d1j08a1 complexed with cl |
PDB Entry: 2hls (more details), 1.93 Å
SCOPe Domain Sequences for d2hlsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hlsa1 c.47.1.0 (A:2-123) automated matches {Aeropyrum pernix [TaxId: 272557]} aryyvldlsedfrrelretlaemvnpvevhvflsksgcetcedtlrlmklfeeesptrng gkllklnvyyresdsdkfsefkvervptvaflggevrwtgipageeiralvevimrlsed es
Timeline for d2hlsa1: