Lineage for d2hkna_ (2hkn A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1784992Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 1784993Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
    Pfam PF01302
  6. 1785018Protein Dynactin 1 [141234] (1 species)
  7. 1785019Species Human (Homo sapiens) [TaxId:9606] [141235] (8 PDB entries)
    Uniprot Q14203 1-99! Uniprot Q14203 25-98
  8. 1785026Domain d2hkna_: 2hkn A: [204620]
    automated match to d2cowa1

Details for d2hkna_

PDB Entry: 2hkn (more details), 1.87 Å

PDB Description: Crystal structure of the CAP-Gly domain of human Dynactin-1 (p150-Glued)
PDB Compounds: (A:) Dynactin-1

SCOPe Domain Sequences for d2hkna_:

Sequence, based on SEQRES records: (download)

>d2hkna_ b.34.10.1 (A:) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]}
shmsaeasarplrvgsrvevigkghrgtvayvgatlfatgkwvgvildeakgkndgtvqg
rkyftcdeghgifvrqsqiqvf

Sequence, based on observed residues (ATOM records): (download)

>d2hkna_ b.34.10.1 (A:) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]}
shmsplrvgsrvevigkghrgtvayvgatlfatgkwvgvildeakgkndgtvqgrkyftc
deghgifvrqsqiqvf

SCOPe Domain Coordinates for d2hkna_:

Click to download the PDB-style file with coordinates for d2hkna_.
(The format of our PDB-style files is described here.)

Timeline for d2hkna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hknb_