Lineage for d2hk9d1 (2hk9 D:1-105)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1376891Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 1376892Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 1377145Family c.58.1.5: Shikimate dehydrogenase-like [82336] (3 proteins)
  6. 1377154Protein Shikimate 5-dehydrogenase AroE [89584] (6 species)
  7. 1377155Species Aquifex aeolicus [TaxId:63363] [225280] (3 PDB entries)
  8. 1377159Domain d2hk9d1: 2hk9 D:1-105 [204616]
    Other proteins in same PDB: d2hk9a2, d2hk9b2, d2hk9c2, d2hk9d2
    automated match to d1nvta2
    complexed with atr, nap, skm

Details for d2hk9d1

PDB Entry: 2hk9 (more details), 2.2 Å

PDB Description: crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and nadp+ at 2.2 angstrom resolution
PDB Compounds: (D:) Shikimate dehydrogenase

SCOPe Domain Sequences for d2hk9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hk9d1 c.58.1.5 (D:1-105) Shikimate 5-dehydrogenase AroE {Aquifex aeolicus [TaxId: 63363]}
minaqtqlygvigfpvkhslspvfqnaliryaglnavylafeinpeelkkafegfkalkv
kginvtvpfkeeiiplldyvedtakeigavntvkfengkaygynt

SCOPe Domain Coordinates for d2hk9d1:

Click to download the PDB-style file with coordinates for d2hk9d1.
(The format of our PDB-style files is described here.)

Timeline for d2hk9d1: