SCOPe 2.07: Domain d2hk9c2: 2hk9 C:106-266

Lineage for d2hk9c2 (2hk9 C:106-266)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Shikimate 5-dehydrogenase AroE [89538] (6 species)

7. Species Aquifex aeolicus [TaxId:63363] [225281] (3 PDB entries)

8. Domain d2hk9c2: 2hk9 C:106-266 [204615]
   Other proteins in same PDB: d2hk9a1, d2hk9b1, d2hk9c1, d2hk9d1
   automated match to d1nvta1
   complexed with atr, nap, skm

Details for d2hk9c2

PDB Entry: 2hk9, 2.2 Å

PDB Description: crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and nadp+ at 2.2 angstrom resolution

PDB Compounds: (C:) Shikimate dehydrogenase

SCOPe Domain Sequences for d2hk9c2:

Sequence; same for both SEQRES and ATOM records:

>d2hk9c2 c.2.1.7 (C:106-266) Shikimate 5-dehydrogenase AroE {Aquifex aeolicus [TaxId: 63363]}
dwigflkslkslipevkeksilvlgaggasraviyalvkegakvflwnrtkekaiklaqk
fplevvnspeevidkvqvivnttsvglkdedpeifnydlikkdhvvvdiiyketkllkka
kekgaklldglpmllwqgieafkiwngcevpysvaersvrd

Timeline for d2hk9c2:

• d2hk9c2 first appeared in SCOPe 2.03
  
• d2hk9c2 appears in SCOPe 2.06
  
• d2hk9c2 appears in the current release, SCOPe 2.08