Lineage for d2hk9c2 (2hk9 C:106-266)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2453552Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2453800Protein Shikimate 5-dehydrogenase AroE [89538] (6 species)
  7. 2453801Species Aquifex aeolicus [TaxId:63363] [225281] (3 PDB entries)
  8. 2453814Domain d2hk9c2: 2hk9 C:106-266 [204615]
    Other proteins in same PDB: d2hk9a1, d2hk9b1, d2hk9c1, d2hk9d1
    automated match to d1nvta1
    complexed with atr, nap, skm

Details for d2hk9c2

PDB Entry: 2hk9 (more details), 2.2 Å

PDB Description: crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and nadp+ at 2.2 angstrom resolution
PDB Compounds: (C:) Shikimate dehydrogenase

SCOPe Domain Sequences for d2hk9c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hk9c2 c.2.1.7 (C:106-266) Shikimate 5-dehydrogenase AroE {Aquifex aeolicus [TaxId: 63363]}
dwigflkslkslipevkeksilvlgaggasraviyalvkegakvflwnrtkekaiklaqk
fplevvnspeevidkvqvivnttsvglkdedpeifnydlikkdhvvvdiiyketkllkka
kekgaklldglpmllwqgieafkiwngcevpysvaersvrd

SCOPe Domain Coordinates for d2hk9c2:

Click to download the PDB-style file with coordinates for d2hk9c2.
(The format of our PDB-style files is described here.)

Timeline for d2hk9c2: