Lineage for d1f3dj1 (1f3d J:1-107)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 547289Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 547441Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (126 PDB entries)
  8. 547457Domain d1f3dj1: 1f3d J:1-107 [20461]
    Other proteins in same PDB: d1f3dh1, d1f3dh2, d1f3dj2, d1f3dk1, d1f3dk2, d1f3dl2
    part of catalytic Fab 4B2
    complexed with so4, tpm

Details for d1f3dj1

PDB Entry: 1f3d (more details), 1.87 Å

PDB Description: catalytic antibody 4b2 in complex with its amidinium hapten.

SCOP Domain Sequences for d1f3dj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3dj1 b.1.1.1 (J:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvlmtqtplslpvslgdqvsiscrssqsifhsdgktylewhlqkpgqspklliykvskrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleik

SCOP Domain Coordinates for d1f3dj1:

Click to download the PDB-style file with coordinates for d1f3dj1.
(The format of our PDB-style files is described here.)

Timeline for d1f3dj1: