Lineage for d2hk8g1 (2hk8 G:1-105)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2498096Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2498097Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2498407Family c.58.1.5: Shikimate dehydrogenase-like [82336] (3 proteins)
  6. 2498416Protein Shikimate 5-dehydrogenase AroE [89584] (6 species)
  7. 2498417Species Aquifex aeolicus [TaxId:63363] [225280] (3 PDB entries)
  8. 2498424Domain d2hk8g1: 2hk8 G:1-105 [204606]
    Other proteins in same PDB: d2hk8a2, d2hk8b2, d2hk8c2, d2hk8d2, d2hk8e2, d2hk8f2, d2hk8g2, d2hk8h2
    automated match to d1nvta2

Details for d2hk8g1

PDB Entry: 2hk8 (more details), 2.35 Å

PDB Description: Crystal structure of shikimate dehydrogenase from aquifex aeolicus at 2.35 angstrom resolution
PDB Compounds: (G:) Shikimate dehydrogenase

SCOPe Domain Sequences for d2hk8g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hk8g1 c.58.1.5 (G:1-105) Shikimate 5-dehydrogenase AroE {Aquifex aeolicus [TaxId: 63363]}
minaqtqlygvigfpvkhslspvfqnaliryaglnavylafeinpeelkkafegfkalkv
kginvtvpfkeeiiplldyvedtakeigavntvkfengkaygynt

SCOPe Domain Coordinates for d2hk8g1:

Click to download the PDB-style file with coordinates for d2hk8g1.
(The format of our PDB-style files is described here.)

Timeline for d2hk8g1: