Lineage for d2hk8e2 (2hk8 E:106-266)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1579636Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 1579871Protein Shikimate 5-dehydrogenase AroE [89538] (6 species)
  7. 1579872Species Aquifex aeolicus [TaxId:63363] [225281] (3 PDB entries)
  8. 1579881Domain d2hk8e2: 2hk8 E:106-266 [204603]
    Other proteins in same PDB: d2hk8a1, d2hk8b1, d2hk8c1, d2hk8d1, d2hk8e1, d2hk8f1, d2hk8g1, d2hk8h1
    automated match to d1nvta1

Details for d2hk8e2

PDB Entry: 2hk8 (more details), 2.35 Å

PDB Description: Crystal structure of shikimate dehydrogenase from aquifex aeolicus at 2.35 angstrom resolution
PDB Compounds: (E:) Shikimate dehydrogenase

SCOPe Domain Sequences for d2hk8e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hk8e2 c.2.1.7 (E:106-266) Shikimate 5-dehydrogenase AroE {Aquifex aeolicus [TaxId: 63363]}
dwigflkslkslipevkeksilvlgaggasraviyalvkegakvflwnrtkekaiklaqk
fplevvnspeevidkvqvivnttsvglkdedpeifnydlikkdhvvvdiiyketkllkka
kekgaklldglpmllwqgieafkiwngcevpysvaersvrd

SCOPe Domain Coordinates for d2hk8e2:

Click to download the PDB-style file with coordinates for d2hk8e2.
(The format of our PDB-style files is described here.)

Timeline for d2hk8e2: